Lineage for d3amba_ (3amb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980113Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2980192Species Human (Homo sapiens) [TaxId:9606] [352703] (8 PDB entries)
  8. 2980201Domain d3amba_: 3amb A: [172245]
    automated match to d1cmke_
    complexed with vx6; mutant

Details for d3amba_

PDB Entry: 3amb (more details), 2.25 Å

PDB Description: Protein kinase A sixfold mutant model of Aurora B with inhibitor VX-680
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3amba_:

Sequence, based on SEQRES records: (download)

>d3amba_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Human (Homo sapiens) [TaxId: 9606]}
aaaakkgseqesvkeflakakedflkkwespaqntahldqferirtlgtgsfgrvmlvkh
ketgnhyamkildkqkvvklkqiehtlnekriqqavnfpflvklefsfkdnsnlymvley
apggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyikv
adfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadq
piqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdw
iaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Sequence, based on observed residues (ATOM records): (download)

>d3amba_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Human (Homo sapiens) [TaxId: 9606]}
aaaakkgseqesvkeflakakedflkkwespaqntahldqferirtlgtgsfgrvmlvkh
ketgnhyamkildkqkvvklkqiehtlnekriqqavnfpflvklefsfkdnsnlymvley
apggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyikv
adfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadq
piqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdw
iaiyqrkveapfipkfksnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d3amba_:

Click to download the PDB-style file with coordinates for d3amba_.
(The format of our PDB-style files is described here.)

Timeline for d3amba_: