![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (19 species) not a true protein |
![]() | Species Cucumaria echinata [TaxId:40245] [189610] (3 PDB entries) |
![]() | Domain d3alud_: 3alu D: [172237] automated match to d1wmya_ complexed with ca, edo, raf |
PDB Entry: 3alu (more details), 1.65 Å
SCOPe Domain Sequences for d3alud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3alud_ d.169.1.0 (D:) automated matches {Cucumaria echinata [TaxId: 40245]} cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle
Timeline for d3alud_: