Lineage for d3aktb_ (3akt B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051349Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2051445Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)
  8. 2051449Domain d3aktb_: 3akt B: [172224]
    automated match to d1enxa_
    complexed with gol

Details for d3aktb_

PDB Entry: 3akt (more details), 1 Å

PDB Description: crystal structure of xylanase from trichoderma longibrachiatum
PDB Compounds: (B:) xylanase

SCOPe Domain Sequences for d3aktb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aktb_ b.29.1.11 (B:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d3aktb_:

Click to download the PDB-style file with coordinates for d3aktb_.
(The format of our PDB-style files is described here.)

Timeline for d3aktb_: