![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries) |
![]() | Domain d3aktb_: 3akt B: [172224] automated match to d1enxa_ complexed with gol |
PDB Entry: 3akt (more details), 1 Å
SCOPe Domain Sequences for d3aktb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aktb_ b.29.1.11 (B:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]} etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf ssgsasitvs
Timeline for d3aktb_: