Lineage for d3akta_ (3akt A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374612Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2374657Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2374753Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)
  8. 2374756Domain d3akta_: 3akt A: [172223]
    automated match to d1enxa_
    complexed with gol

Details for d3akta_

PDB Entry: 3akt (more details), 1 Å

PDB Description: Crystal structure of xylanase from Trichoderma longibrachiatum
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3akta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3akta_ b.29.1.11 (A:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d3akta_:

Click to download the PDB-style file with coordinates for d3akta_.
(The format of our PDB-style files is described here.)

Timeline for d3akta_: