Lineage for d3akra_ (3akr A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051349Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2051445Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)
  8. 2051450Domain d3akra_: 3akr A: [172221]
    automated match to d1enxa_
    complexed with gol, na

Details for d3akra_

PDB Entry: 3akr (more details), 1.1 Å

PDB Description: crystal structure of xylanase from trichoderma longibrachiatum
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3akra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3akra_ b.29.1.11 (A:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d3akra_:

Click to download the PDB-style file with coordinates for d3akra_.
(The format of our PDB-style files is described here.)

Timeline for d3akra_: