SCOP 1.65: Domain d1ncx__: 1ncx -

Lineage for d1ncx__ (1ncx -)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (18 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (5 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (24 PDB entries)

8. Domain d1ncx__: 1ncx - [17222]
   complexed with cd, so4

Details for d1ncx__

PDB Entry: 1ncx, 1.8 Å

PDB Description: troponin c

SCOP Domain Sequences for d1ncx__:

Sequence; same for both SEQRES and ATOM records:

>d1ncx__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
ilratgehvteediedlmkdsdknndgridfdeflkmmegvq

Timeline for d1ncx__:

• d1ncx__ first appeared (with stable ids) in SCOP 1.55
  
• d1ncx__ appears in SCOP 1.63
  
• d1ncx__ appears in SCOP 1.67
  
• d1ncx__ appears in the current release, SCOPe 2.08, called d1ncxa_