SCOPe 2.08: Domain d3akpb_: 3akp B:

Lineage for d3akpb_ (3akp B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)

8. Domain d3akpb_: 3akp B: [172219]
   automated match to d1enxa_
   complexed with gol

Details for d3akpb_

PDB Entry: 3akp, 1.2 Å

PDB Description: crystal structure of xylanase from trichoderma longibrachiatum

PDB Compounds: (B:) xylanase

SCOPe Domain Sequences for d3akpb_:

Sequence; same for both SEQRES and ATOM records:

>d3akpb_ b.29.1.11 (B:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d3akpb_:

• d3akpb_ first appeared in SCOPe 2.01
  
• d3akpb_ appears in SCOPe 2.07