SCOPe 2.05: Domain d3akpa_: 3akp A:

Lineage for d3akpa_ (3akp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)

8. Domain d3akpa_: 3akp A: [172218]
   automated match to d1enxa_
   complexed with gol

Details for d3akpa_

PDB Entry: 3akp, 1.2 Å

PDB Description: crystal structure of xylanase from trichoderma longibrachiatum

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3akpa_:

Sequence; same for both SEQRES and ATOM records:

>d3akpa_ b.29.1.11 (A:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d3akpa_:

• d3akpa_ first appeared in SCOPe 2.01
  
• d3akpa_ appears in SCOPe 2.04
  
• d3akpa_ appears in SCOPe 2.06
  
• d3akpa_ appears in the current release, SCOPe 2.08