Lineage for d3akpa_ (3akp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780208Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)
  8. 2780214Domain d3akpa_: 3akp A: [172218]
    automated match to d1enxa_
    complexed with gol

Details for d3akpa_

PDB Entry: 3akp (more details), 1.2 Å

PDB Description: crystal structure of xylanase from trichoderma longibrachiatum
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d3akpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3akpa_ b.29.1.11 (A:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d3akpa_:

Click to download the PDB-style file with coordinates for d3akpa_.
(The format of our PDB-style files is described here.)

Timeline for d3akpa_: