Lineage for d3akda_ (3akd A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990511Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 990512Protein automated matches [190123] (20 species)
    not a true protein
  7. 990649Species Thermus thermophilus [TaxId:300852] [189850] (3 PDB entries)
  8. 990651Domain d3akda_: 3akd A: [172216]
    automated match to d1kdoa_
    complexed with cdp

Details for d3akda_

PDB Entry: 3akd (more details), 1.6 Å

PDB Description: Crystal structure of CMP kinase in complex with CDP from Thermus thermophilus HB8
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d3akda_:

Sequence, based on SEQRES records: (download)

>d3akda_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mrgivtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllal
leglgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevppp
fvaegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrderdkaqsa
papdalvldtggmtldevvawvlahirr

Sequence, based on observed residues (ATOM records): (download)

>d3akda_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mrgivtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllal
leglgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevppp
fvaegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrdsapapdal
vldtggmtldevvawvlahirr

SCOPe Domain Coordinates for d3akda_:

Click to download the PDB-style file with coordinates for d3akda_.
(The format of our PDB-style files is described here.)

Timeline for d3akda_: