Lineage for d3akca_ (3akc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873033Species Thermus thermophilus HB8 [TaxId:300852] [189850] (10 PDB entries)
  8. 2873037Domain d3akca_: 3akc A: [172215]
    automated match to d1kdoa_
    complexed with adp, cdp, gd

Details for d3akca_

PDB Entry: 3akc (more details), 1.65 Å

PDB Description: Crystal structure of CMP kinase in complex with CDP and ADP from Thermus thermophilus HB8
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d3akca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3akca_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrgivtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllal
leglgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevppp
fvaegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrderdkaqsa
papdalvldtggmtldevvawvlahirr

SCOPe Domain Coordinates for d3akca_:

Click to download the PDB-style file with coordinates for d3akca_.
(The format of our PDB-style files is described here.)

Timeline for d3akca_: