Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (27 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187027] (25 PDB entries) |
Domain d3ajqa_: 3ajq A: [172213] automated match to d1fhaa_ complexed with mg; mutant |
PDB Entry: 3ajq (more details), 1.58 Å
SCOPe Domain Sequences for d3ajqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ajqa_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk ndphlcdfiethylnqqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
Timeline for d3ajqa_: