| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (18 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187027] (11 PDB entries) |
| Domain d3ajoa_: 3ajo A: [172211] automated match to d1fhaa_ complexed with mg |
PDB Entry: 3ajo (more details), 1.52 Å
SCOPe Domain Sequences for d3ajoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ajoa_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
Timeline for d3ajoa_: