SCOPe 2.07: Domain d3ajic_: 3aji C:

Lineage for d3ajic_ (3aji C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [187642] (2 PDB entries)

8. Domain d3ajic_: 3aji C: [172210]
   automated match to d1tr4a_

Details for d3ajic_

PDB Entry: 3aji, 2.05 Å

PDB Description: Structure of Gankyrin-S6ATPase photo-cross-linked site-specifically, and incoporated by genetic code expansion

PDB Compounds: (C:) 26S proteasome non-ATPase regulatory subunit 10

SCOPe Domain Sequences for d3ajic_:

Sequence; same for both SEQRES and ATOM records:

>d3ajic_ d.211.1.1 (C:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Mouse (Mus musculus) [TaxId: 10090]}
gcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllql
gvpvndkddagwsplhiaasagfdeivkallvkgahvnavnqngctplhyaasknrheia
vmllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacde
erveeakflvtqgasiyienkeektplqvakgglglilkrlaegeeasm

Timeline for d3ajic_:

• d3ajic_ first appeared in SCOPe 2.01
  
• d3ajic_ appears in SCOPe 2.06
  
• d3ajic_ appears in the current release, SCOPe 2.08