Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [187642] (2 PDB entries) |
Domain d3ajia_: 3aji A: [172209] automated match to d1tr4a_ |
PDB Entry: 3aji (more details), 2.05 Å
SCOPe Domain Sequences for d3ajia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ajia_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Mouse (Mus musculus) [TaxId: 10090]} gcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllql gvpvndkddagwsplhiaasagfdeivkallvkgahvnavnqngctplhyaasknrheia vmllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacde erveeakflvtqgasiyienkeektplqvakgglglilkrlaegeeasm
Timeline for d3ajia_: