Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.14: FliG [48029] (2 families) fragmented superhelix; consist of 3/4-helical motifs and connecting helices |
Family a.118.14.1: FliG [48030] (2 proteins) |
Protein automated matches [191292] (1 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [189946] (1 PDB entry) |
Domain d3ajca_: 3ajc A: [172208] automated match to d1lkvx_ mutant |
PDB Entry: 3ajc (more details), 2.3 Å
SCOPe Domain Sequences for d3ajca_:
Sequence, based on SEQRES records: (download)
>d3ajca_ a.118.14.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} vkpfsfvrdtdpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkrial lertsvkeiernlekkisgfvsrtfskvggidtaaeimnnldrttekkimdklvqenpel adeirrrmfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaal lkdeleymgpvrlkdveeaqqkiiniirrleeageivi
>d3ajca_ a.118.14.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} vkpfsfvrdtdpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkrial lertsvkeiernlekkisgvggidtaaeimnnldrttekkimdklvqenpeladeirrrm fvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeleym gpvrlkdveeaqqkiiniirrleeageivi
Timeline for d3ajca_: