Lineage for d3ajca_ (3ajc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007853Superfamily a.118.14: FliG [48029] (2 families) (S)
    fragmented superhelix; consist of 3/4-helical motifs and connecting helices
  5. 2007854Family a.118.14.1: FliG [48030] (2 protein domains)
  6. 2007861Protein automated matches [191292] (1 species)
    not a true protein
  7. 2007862Species Thermotoga maritima [TaxId:2336] [189946] (1 PDB entry)
  8. 2007863Domain d3ajca_: 3ajc A: [172208]
    automated match to d1lkvx_
    mutant

Details for d3ajca_

PDB Entry: 3ajc (more details), 2.3 Å

PDB Description: Structure of the MC domain of FliG (PEV), a CW-biased mutant
PDB Compounds: (A:) Flagellar motor switch protein fliG

SCOPe Domain Sequences for d3ajca_:

Sequence, based on SEQRES records: (download)

>d3ajca_ a.118.14.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkpfsfvrdtdpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkrial
lertsvkeiernlekkisgfvsrtfskvggidtaaeimnnldrttekkimdklvqenpel
adeirrrmfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaal
lkdeleymgpvrlkdveeaqqkiiniirrleeageivi

Sequence, based on observed residues (ATOM records): (download)

>d3ajca_ a.118.14.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkpfsfvrdtdpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkrial
lertsvkeiernlekkisgvggidtaaeimnnldrttekkimdklvqenpeladeirrrm
fvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeleym
gpvrlkdveeaqqkiiniirrleeageivi

SCOPe Domain Coordinates for d3ajca_:

Click to download the PDB-style file with coordinates for d3ajca_.
(The format of our PDB-style files is described here.)

Timeline for d3ajca_: