Lineage for d3aiaa1 (3aia A:2-200)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168545Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2168546Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2168732Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2168733Protein automated matches [190961] (16 species)
    not a true protein
  7. 2168785Species Methanocaldococcus jannaschii [TaxId:2190] [189685] (2 PDB entries)
  8. 2168786Domain d3aiaa1: 3aia A:2-200 [172204]
    Other proteins in same PDB: d3aiaa2, d3aiab2
    automated match to d2qmma1
    complexed with pbl, sam

Details for d3aiaa1

PDB Entry: 3aia (more details), 1.4 Å

PDB Description: Crystal structure of DUF358 reveals a putative SPOUT-class methltransferase
PDB Compounds: (A:) UPF0217 protein MJ1640

SCOPe Domain Sequences for d3aiaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aiaa1 c.116.1.0 (A:2-200) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
refifkanktitssdinlkdlpgscgrldllcrcvsdafflshdirrdvvfyavlygqpn
ppvcikfvgselkkvspderniaifikkalkkfeeldeeqrkdwnqstpgiyvrrlgfrn
lvlekleegkniyylhmngedvenvdienpvfiigdhigigeederfldeikakrislsp
lelhanhcitiihnvldkk

SCOPe Domain Coordinates for d3aiaa1:

Click to download the PDB-style file with coordinates for d3aiaa1.
(The format of our PDB-style files is described here.)

Timeline for d3aiaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3aiaa2