![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.4: Parvalbumin [47492] (3 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
![]() | Protein Parvalbumin [47495] (9 species) |
![]() | Domain d1rtp2_: 1rtp 2: [17220] complexed with ca |
PDB Entry: 1rtp (more details), 2 Å
SCOPe Domain Sequences for d1rtp2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtp2_ a.39.1.4 (2:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes
Timeline for d1rtp2_: