Lineage for d3ai1a_ (3ai1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846952Species Gluconobacter frateurii [TaxId:38308] [189629] (3 PDB entries)
  8. 2846965Domain d3ai1a_: 3ai1 A: [172189]
    automated match to d1i01a_

Details for d3ai1a_

PDB Entry: 3ai1 (more details), 2.38 Å

PDB Description: The crystal structure of L-sorbose reductase from Gluconobacter frateurii complexed with NADPH and L-sorbose reveals the structure bases of its catalytic mechanism and high substrate selectivity
PDB Compounds: (A:) NADPH-sorbose reductase

SCOPe Domain Sequences for d3ai1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ai1a_ c.2.1.0 (A:) automated matches {Gluconobacter frateurii [TaxId: 38308]}
mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
cseratysvgsayfvdggmlktl

SCOPe Domain Coordinates for d3ai1a_:

Click to download the PDB-style file with coordinates for d3ai1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ai1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ai1b_