Lineage for d3ahxc_ (3ahx C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082956Species Clostridium cellulovorans [TaxId:1493] [189410] (1 PDB entry)
  8. 2082959Domain d3ahxc_: 3ahx C: [172185]
    automated match to d1od0a_
    complexed with 7pe

Details for d3ahxc_

PDB Entry: 3ahx (more details), 1.9 Å

PDB Description: Crystal structure of beta-glucosidase A from bacterium Clostridium cellulovorans
PDB Compounds: (C:) beta-glucosidase a

SCOPe Domain Sequences for d3ahxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ahxc_ c.1.8.4 (C:) Beta-glucosidase A {Clostridium cellulovorans [TaxId: 1493]}
lrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhryke
dvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiyhwd
lpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvhapg
ikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaahrsd
gwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqvvkn
nseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndmvnr
dgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhvnyk
tqertikksaywykeliersn

SCOPe Domain Coordinates for d3ahxc_:

Click to download the PDB-style file with coordinates for d3ahxc_.
(The format of our PDB-style files is described here.)

Timeline for d3ahxc_: