Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein Beta-glucosidase A [51528] (9 species) |
Species Clostridium cellulovorans [TaxId:1493] [189410] (1 PDB entry) |
Domain d3ahxa_: 3ahx A: [172183] automated match to d1od0a_ complexed with 7pe |
PDB Entry: 3ahx (more details), 1.9 Å
SCOPe Domain Sequences for d3ahxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ahxa_ c.1.8.4 (A:) Beta-glucosidase A {Clostridium cellulovorans [TaxId: 1493]} meklrfpkdfifgtataayqiegaykedekgesiwdrfshipgnvakmhngdiacdhyhr ykedvqllkslgiksyrfsiawprifpkgfgeinqkgiqfyrdlidelikndiepaitiy hwdlpqklqdiggwanpqvadyyvdyanllfrefgdrvktwithnepwvasylgyalgvh apgikdmkmallaahnillshfkavkayreleqdgqigitlnlstcysnsadeediaaah rsdgwnnrwfldaalkgtypedmikifsdtnimpelpkelftevfetsdflginyytrqv vknnseafigaesvamdnpktemgweiypqglydlltrihrdygnidlyitengaafndm vnrdgkvedenrldylythfaaalsaieagvplkgyyiwsfmdnfewaegyekrfgivhv nyktqertikksaywykeliersn
Timeline for d3ahxa_: