SCOPe 2.06: Domain d3ahsc_: 3ahs C:

Lineage for d3ahsc_ (3ahs C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase U2 [53942] (1 species)

7. Species Ustilago sphaerogena [TaxId:5271] [53943] (5 PDB entries)

8. Domain d3ahsc_: 3ahs C: [172181]
   automated match to d1rtua_
   complexed with gol, k, po4

Details for d3ahsc_

PDB Entry: 3ahs, 1.32 Å

PDB Description: Crystal Structure of Ustilago sphaerogena Ribonuclease U2B

PDB Compounds: (C:) Ribonuclease U2

SCOPe Domain Sequences for d3ahsc_:

Sequence, based on SEQRES records:

>d3ahsc_ d.1.1.4 (C:) RNase U2 {Ustilago sphaerogena [TaxId: 5271]}
cdipqstncggnvysnddintaiqgalddvadgdrpdnyphqyydeaseditlccgsgpw
sefplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

Sequence, based on observed residues (ATOM records):

>d3ahsc_ d.1.1.4 (C:) RNase U2 {Ustilago sphaerogena [TaxId: 5271]}
cdipqstncggnvysnddintaiqgaldrpdnyphqyydeaseditlccgsgpwsefplv
yngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

Timeline for d3ahsc_:

• d3ahsc_ first appeared in SCOPe 2.01
  
• d3ahsc_ appears in SCOPe 2.05
  
• d3ahsc_ appears in SCOPe 2.07
  
• d3ahsc_ appears in the current release, SCOPe 2.08