Lineage for d3ahsc_ (3ahs C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494861Family d.1.1.4: Fungal ribonucleases [81311] (4 protein domains)
  6. 2494977Protein RNase U2 [53942] (1 species)
  7. 2494978Species Ustilago sphaerogena [TaxId:5271] [53943] (5 PDB entries)
  8. 2494984Domain d3ahsc_: 3ahs C: [172181]
    automated match to d1rtua_
    complexed with gol, k, po4

Details for d3ahsc_

PDB Entry: 3ahs (more details), 1.32 Å

PDB Description: Crystal Structure of Ustilago sphaerogena Ribonuclease U2B
PDB Compounds: (C:) Ribonuclease U2

SCOPe Domain Sequences for d3ahsc_:

Sequence, based on SEQRES records: (download)

>d3ahsc_ d.1.1.4 (C:) RNase U2 {Ustilago sphaerogena [TaxId: 5271]}
cdipqstncggnvysnddintaiqgalddvadgdrpdnyphqyydeaseditlccgsgpw
sefplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

Sequence, based on observed residues (ATOM records): (download)

>d3ahsc_ d.1.1.4 (C:) RNase U2 {Ustilago sphaerogena [TaxId: 5271]}
cdipqstncggnvysnddintaiqgaldrpdnyphqyydeaseditlccgsgpwsefplv
yngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

SCOPe Domain Coordinates for d3ahsc_:

Click to download the PDB-style file with coordinates for d3ahsc_.
(The format of our PDB-style files is described here.)

Timeline for d3ahsc_: