SCOPe 2.06: Domain d3ahsb_: 3ahs B:

Lineage for d3ahsb_ (3ahs B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase U2 [53942] (1 species)

7. Species Ustilago sphaerogena [TaxId:5271] [53943] (5 PDB entries)

8. Domain d3ahsb_: 3ahs B: [172180]
   automated match to d1rtua_
   complexed with gol, k, po4

Details for d3ahsb_

PDB Entry: 3ahs, 1.32 Å

PDB Description: Crystal Structure of Ustilago sphaerogena Ribonuclease U2B

PDB Compounds: (B:) Ribonuclease U2

SCOPe Domain Sequences for d3ahsb_:

Sequence; same for both SEQRES and ATOM records:

>d3ahsb_ d.1.1.4 (B:) RNase U2 {Ustilago sphaerogena [TaxId: 5271]}
cdipqstncggnvysnddintaiqgalddvadgdrpdnyphqyydeaseditlccgsgpw
sefplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

Timeline for d3ahsb_:

• d3ahsb_ first appeared in SCOPe 2.01
  
• d3ahsb_ appears in SCOPe 2.05
  
• d3ahsb_ appears in SCOPe 2.07
  
• d3ahsb_ appears in the current release, SCOPe 2.08