![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins) |
![]() | Protein RNase U2 [53942] (1 species) |
![]() | Species Ustilago sphaerogena [TaxId:5271] [53943] (5 PDB entries) |
![]() | Domain d3ahsa_: 3ahs A: [172179] automated match to d1rtua_ complexed with gol, k, po4 |
PDB Entry: 3ahs (more details), 1.32 Å
SCOPe Domain Sequences for d3ahsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ahsa_ d.1.1.4 (A:) RNase U2 {Ustilago sphaerogena [TaxId: 5271]} cdipqstncggnvysnddintaiqgalddvadgdrpdnyphqyydeaseditlccgsgpw sefplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs
Timeline for d3ahsa_: