Lineage for d3ahsa_ (3ahs A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2924039Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)
  6. 2924155Protein RNase U2 [53942] (1 species)
  7. 2924156Species Ustilago sphaerogena [TaxId:5271] [53943] (5 PDB entries)
  8. 2924160Domain d3ahsa_: 3ahs A: [172179]
    automated match to d1rtua_
    complexed with gol, k, po4

Details for d3ahsa_

PDB Entry: 3ahs (more details), 1.32 Å

PDB Description: Crystal Structure of Ustilago sphaerogena Ribonuclease U2B
PDB Compounds: (A:) Ribonuclease U2

SCOPe Domain Sequences for d3ahsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ahsa_ d.1.1.4 (A:) RNase U2 {Ustilago sphaerogena [TaxId: 5271]}
cdipqstncggnvysnddintaiqgalddvadgdrpdnyphqyydeaseditlccgsgpw
sefplvyngpyyssrdnyvspgpdrviyqtntgefcatvthtgaasydgftqcs

SCOPe Domain Coordinates for d3ahsa_:

Click to download the PDB-style file with coordinates for d3ahsa_.
(The format of our PDB-style files is described here.)

Timeline for d3ahsa_: