SCOPe 2.01: Domain d3ah7a_: 3ah7 A:

Lineage for d3ah7a_ (3ah7 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (4 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [189910] (1 PDB entry)

8. Domain d3ah7a_: 3ah7 A: [172176]
   automated match to d1i7ha_
   complexed with cl, fes, na

Details for d3ah7a_

PDB Entry: 3ah7, 1.9 Å

PDB Description: Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004

PDB Compounds: (A:) [2Fe-2S]ferredoxin

SCOPe Domain Sequences for d3ah7a_:

Sequence; same for both SEQRES and ATOM records:

>d3ah7a_ d.15.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
mplvtflphekfcpegltvevkpgtnilelahdhhiemesacggvkacttchcivrkgfd
sleeadeleedmldkawgleaqsrlgcqvfvadedltieipkyslnhaa

Timeline for d3ah7a_:

• d3ah7a_ is new in SCOPe 2.01-stable
  
• d3ah7a_ appears in SCOPe 2.02
  
• d3ah7a_ appears in the current release, SCOPe 2.08, called d3ah7a1