![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [189910] (1 PDB entry) |
![]() | Domain d3ah7a1: 3ah7 A:1-108 [172176] Other proteins in same PDB: d3ah7a2 automated match to d1i7ha_ complexed with cl, fes, na |
PDB Entry: 3ah7 (more details), 1.9 Å
SCOPe Domain Sequences for d3ah7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ah7a1 d.15.4.0 (A:1-108) automated matches {Pseudomonas putida [TaxId: 303]} plvtflphekfcpegltvevkpgtnilelahdhhiemesacggvkacttchcivrkgfds leeadeleedmldkawgleaqsrlgcqvfvadedltieipkyslnhaa
Timeline for d3ah7a1: