Lineage for d3ah7a1 (3ah7 A:1-108)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934300Species Pseudomonas putida [TaxId:303] [189910] (1 PDB entry)
  8. 2934301Domain d3ah7a1: 3ah7 A:1-108 [172176]
    Other proteins in same PDB: d3ah7a2
    automated match to d1i7ha_
    complexed with cl, fes, na

Details for d3ah7a1

PDB Entry: 3ah7 (more details), 1.9 Å

PDB Description: Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004
PDB Compounds: (A:) [2Fe-2S]ferredoxin

SCOPe Domain Sequences for d3ah7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah7a1 d.15.4.0 (A:1-108) automated matches {Pseudomonas putida [TaxId: 303]}
plvtflphekfcpegltvevkpgtnilelahdhhiemesacggvkacttchcivrkgfds
leeadeleedmldkawgleaqsrlgcqvfvadedltieipkyslnhaa

SCOPe Domain Coordinates for d3ah7a1:

Click to download the PDB-style file with coordinates for d3ah7a1.
(The format of our PDB-style files is described here.)

Timeline for d3ah7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ah7a2