SCOPe 2.01: Domain d3ah6f_: 3ah6 F:

Lineage for d3ah6f_ (3ah6 F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Escherichia coli [TaxId:562] [102973] (4 PDB entries)

8. Domain d3ah6f_: 3ah6 F: [172175]
   automated match to d1naqa_

Details for d3ah6f_

PDB Entry: 3ah6, 2.4 Å

PDB Description: Remarkable improvement of the heat stability of CutA1 from E.coli by rational protein designing

PDB Compounds: (F:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3ah6f_:

Sequence; same for both SEQRES and ATOM records:

>d3ah6f_ d.58.5.2 (F:) Cut A1 {Escherichia coli [TaxId: 562]}
tavvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl

Timeline for d3ah6f_:

• d3ah6f_ is new in SCOPe 2.01-stable
  
• d3ah6f_ appears in SCOPe 2.02
  
• d3ah6f_ appears in the current release, SCOPe 2.08