![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
![]() | Protein Cut A1 [89931] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [102973] (4 PDB entries) |
![]() | Domain d3ah6a_: 3ah6 A: [172170] automated match to d1naqa_ |
PDB Entry: 3ah6 (more details), 2.4 Å
SCOPe Domain Sequences for d3ah6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ah6a_ d.58.5.2 (A:) Cut A1 {Escherichia coli [TaxId: 562]} tavvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmilkt tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl
Timeline for d3ah6a_: