Lineage for d1a75b_ (1a75 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.4: Parvalbumin [47492] (2 proteins) Protein Parvalbumin [47495] (6 species) 
Species Whiting (Merlangius merlangus) [TaxId:8058] [47499] (1 PDB entry) 
Domain d1a75b_: 1a75 B: [17217]
Details for d1a75b_
PDB Entry: 1a75 (more details), 1.9 Å
PDB Description: whiting parvalbumin
SCOP Domain Sequences for d1a75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a75b_ a.39.1.4 (B:) Parvalbumin {Whiting (Merlangius merlangus)}
afagiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfiee
delklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka
SCOP Domain Coordinates for d1a75b_:
Click to download the PDB-style file with coordinates for d1a75b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a75b_:
- d1a75b_ appears in SCOP 1.57
- d1a75b_ appears in the current release, SCOPe 2.08
View in 3D
