![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
![]() | Protein automated matches [190603] (25 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:262724] [189625] (2 PDB entries) |
![]() | Domain d3ah3c_: 3ah3 C: [172164] automated match to d1wpwa_ complexed with edo, so4 |
PDB Entry: 3ah3 (more details), 2.4 Å
SCOPe Domain Sequences for d3ah3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ah3c_ c.77.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 262724]} ayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkils chatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivrent eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl fldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmggl glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav dlvlergpmtpdlggdatteafteavvealksl
Timeline for d3ah3c_: