Lineage for d3ah3c_ (3ah3 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906416Species Thermus thermophilus [TaxId:262724] [189625] (2 PDB entries)
  8. 2906419Domain d3ah3c_: 3ah3 C: [172164]
    automated match to d1wpwa_
    complexed with edo, so4

Details for d3ah3c_

PDB Entry: 3ah3 (more details), 2.4 Å

PDB Description: Crystal structure of LR5-1, 3-isopropylmalate dehydrogenase created by directed evolution
PDB Compounds: (C:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d3ah3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah3c_ c.77.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 262724]}
ayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkils
chatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivrent
eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
fldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmggl
glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
dlvlergpmtpdlggdatteafteavvealksl

SCOPe Domain Coordinates for d3ah3c_:

Click to download the PDB-style file with coordinates for d3ah3c_.
(The format of our PDB-style files is described here.)

Timeline for d3ah3c_: