SCOPe 2.07: Domain d3ah3b_: 3ah3 B:

Lineage for d3ah3b_ (3ah3 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (17 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [189625] (2 PDB entries)

8. Domain d3ah3b_: 3ah3 B: [172163]
   automated match to d1wpwa_
   complexed with edo, so4

Details for d3ah3b_

PDB Entry: 3ah3, 2.4 Å

PDB Description: Crystal structure of LR5-1, 3-isopropylmalate dehydrogenase created by directed evolution

PDB Compounds: (B:) Homoisocitrate dehydrogenase

SCOPe Domain Sequences for d3ah3b_:

Sequence; same for both SEQRES and ATOM records:

>d3ah3b_ c.77.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
ayricliegdgigyevipaarrvleatglplefveaeagwetferrgtsvpeetvvkils
chatlfgaatiptrkvpgffgaimalrrrldlyanvrpaksrpvpgsrpgvdlvivrent
eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
fldtvkevakdfplvnvqdiivdncatqlvmrperydvivttnllgdilsdlaaglmggl
glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
dlvlergpmtpdlggdatteafteavvealksl

Timeline for d3ah3b_:

• d3ah3b_ first appeared in SCOPe 2.01
  
• d3ah3b_ appears in SCOPe 2.06