![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein Hemagglutinin component Ha1 [101784] (2 species) |
![]() | Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries) |
![]() | Domain d3ah2b1: 3ah2 B:4-148 [172160] automated match to d1qxma1 complexed with nga |
PDB Entry: 3ah2 (more details), 1.7 Å
SCOPe Domain Sequences for d3ah2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ah2b1 b.42.2.1 (B:4-148) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]} tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt lmvstqtsssnqffkfsnciyealn
Timeline for d3ah2b1: