Lineage for d3ah2a2 (3ah2 A:149-286)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543454Protein Hemagglutinin component Ha1 [101784] (2 species)
  7. 1543460Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries)
  8. 1543462Domain d3ah2a2: 3ah2 A:149-286 [172159]
    automated match to d1qxma2
    complexed with nga

Details for d3ah2a2

PDB Entry: 3ah2 (more details), 1.7 Å

PDB Description: ha1 subcomponent of botulinum type c progenitor toxin complexed with n-acetylgalactosamine
PDB Compounds: (A:) Main hemagglutinin component

SCOPe Domain Sequences for d3ah2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah2a2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]}
nrncklqtqlnsdrflsknlnsqiivlwqwfdssrqkwiieynetksaytlkcqennryl
twiqnsnnyvetyqstdsliqywninyldndaskyilynlqdtnrvldvynsqiangthv
ivdsyhgntnqqwiinli

SCOPe Domain Coordinates for d3ah2a2:

Click to download the PDB-style file with coordinates for d3ah2a2.
(The format of our PDB-style files is described here.)

Timeline for d3ah2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ah2a1