SCOPe 2.04: Domain d3ah1b1: 3ah1 B:-1-148

Lineage for d3ah1b1 (3ah1 B:-1-148)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Hemagglutinin component Ha1 [101784] (2 species)

7. Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries)

8. Domain d3ah1b1: 3ah1 B:-1-148 [172156]
   automated match to d1qxma1
   complexed with slb

Details for d3ah1b1

PDB Entry: 3ah1, 2.2 Å

PDB Description: ha1 subcomponent of botulinum type c progenitor toxin complexed with n-acetylneuramic acid

PDB Compounds: (B:) Main hemagglutinin component

SCOPe Domain Sequences for d3ah1b1:

Sequence; same for both SEQRES and ATOM records:

>d3ah1b1 b.42.2.1 (B:-1-148) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]}
wimsqtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqa
ykikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqy
niddtlmvstqtsssnqffkfsnciyealn

Timeline for d3ah1b1:

• d3ah1b1 first appeared in SCOPe 2.01
  
• d3ah1b1 appears in SCOPe 2.03
  
• d3ah1b1 appears in SCOPe 2.05
  
• d3ah1b1 appears in the current release, SCOPe 2.08