Lineage for d3ah1b1 (3ah1 B:1-148)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792112Protein Hemagglutinin component Ha1 [101784] (2 species)
  7. 2792118Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries)
  8. 2792129Domain d3ah1b1: 3ah1 B:1-148 [172156]
    Other proteins in same PDB: d3ah1b3
    automated match to d1qxma1
    complexed with slb

Details for d3ah1b1

PDB Entry: 3ah1 (more details), 2.2 Å

PDB Description: ha1 subcomponent of botulinum type c progenitor toxin complexed with n-acetylneuramic acid
PDB Compounds: (B:) Main hemagglutinin component

SCOPe Domain Sequences for d3ah1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah1b1 b.42.2.1 (B:1-148) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]}
msqtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqayk
ikvmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyni
ddtlmvstqtsssnqffkfsnciyealn

SCOPe Domain Coordinates for d3ah1b1:

Click to download the PDB-style file with coordinates for d3ah1b1.
(The format of our PDB-style files is described here.)

Timeline for d3ah1b1: