![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
![]() | Protein Hemagglutinin component Ha1 [101784] (2 species) |
![]() | Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries) |
![]() | Domain d3ah1a2: 3ah1 A:149-286 [172155] Other proteins in same PDB: d3ah1b3 automated match to d1qxma2 complexed with slb |
PDB Entry: 3ah1 (more details), 2.2 Å
SCOPe Domain Sequences for d3ah1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ah1a2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]} nrncklqtqlnsdrflsknlnsqiivlwqwfdssrqkwiieynetksaytlkcqennryl twiqnsnnyvetyqstdsliqywninyldndaskyilynlqdtnrvldvynsqiangthv ivdsyhgntnqqwiinli
Timeline for d3ah1a2: