Lineage for d3ah1a1 (3ah1 A:4-148)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126115Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1126347Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 1126348Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1126374Protein Hemagglutinin component Ha1 [101784] (2 species)
  7. 1126380Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries)
  8. 1126389Domain d3ah1a1: 3ah1 A:4-148 [172154]
    automatically matched to d1qxma1
    complexed with slb

Details for d3ah1a1

PDB Entry: 3ah1 (more details), 2.2 Å

PDB Description: ha1 subcomponent of botulinum type c progenitor toxin complexed with n-acetylneuramic acid
PDB Compounds: (A:) Main hemagglutinin component

SCOPe Domain Sequences for d3ah1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ah1a1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]}
tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
lmvstqtsssnqffkfsnciyealn

SCOPe Domain Coordinates for d3ah1a1:

Click to download the PDB-style file with coordinates for d3ah1a1.
(The format of our PDB-style files is described here.)

Timeline for d3ah1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ah1a2