Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Hemagglutinin component Ha1 [101784] (2 species) |
Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries) |
Domain d3ah1a1: 3ah1 A:4-148 [172154] automatically matched to d1qxma1 complexed with slb |
PDB Entry: 3ah1 (more details), 2.2 Å
SCOPe Domain Sequences for d3ah1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ah1a1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]} tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt lmvstqtsssnqffkfsnciyealn
Timeline for d3ah1a1: