Lineage for d5pala_ (5pal A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087919Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 1087925Protein Parvalbumin [47495] (8 species)
  7. 1087938Species Leopard shark (Triakis semifasciata) [TaxId:30493] [47498] (1 PDB entry)
  8. 1087939Domain d5pala_: 5pal A: [17215]
    complexed with ca

Details for d5pala_

PDB Entry: 5pal (more details), 1.54 Å

PDB Description: crystal structure of the unique parvalbumin component from muscle of the leopard shark (triakis semifasciata). the first x-ray study of an alpha-parvalbumin
PDB Compounds: (A:) parvalbumin

SCOPe Domain Sequences for d5pala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}
pmtkvlkaddinkaisafkdpgtfdykrffhlvglkgktdaqvkevfeildkdqsgfiee
eelkgvlkgfsahgrdlndtetkallaagdsdhdgkigadefakmvaqa

SCOPe Domain Coordinates for d5pala_:

Click to download the PDB-style file with coordinates for d5pala_.
(The format of our PDB-style files is described here.)

Timeline for d5pala_: