Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (41 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [189395] (2 PDB entries) |
Domain d3ag6b_: 3ag6 B: [172143] automated match to d1v8fa_ complexed with acy, paj, pg4 |
PDB Entry: 3ag6 (more details), 1.85 Å
SCOPe Domain Sequences for d3ag6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag6b_ c.26.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]} mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp lqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlega krpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivrea dglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiseri eevavysypqlveqheitgrifislavkfskarlidniiigae
Timeline for d3ag6b_: