Lineage for d3ag6b_ (3ag6 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359851Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1359852Protein automated matches [190459] (31 species)
    not a true protein
  7. 1359982Species Staphylococcus aureus [TaxId:93061] [189395] (2 PDB entries)
  8. 1359984Domain d3ag6b_: 3ag6 B: [172143]
    automated match to d1v8fa_
    complexed with acy, paj, pg4

Details for d3ag6b_

PDB Entry: 3ag6 (more details), 1.85 Å

PDB Description: Crystal Structure of Pantothenate Synthetase from Staphylococcus aureus in complex with pantoyl adenylate
PDB Compounds: (B:) Pantothenate synthetase

SCOPe Domain Sequences for d3ag6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag6b_ c.26.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
lqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlega
krpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivrea
dglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiseri
eevavysypqlveqheitgrifislavkfskarlidniiigae

SCOPe Domain Coordinates for d3ag6b_:

Click to download the PDB-style file with coordinates for d3ag6b_.
(The format of our PDB-style files is described here.)

Timeline for d3ag6b_: