Lineage for d3ag4u_ (3ag4 U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327946Protein automated matches [190271] (1 species)
    not a true protein
  7. 2327947Species Cow (Bos taurus) [TaxId:9913] [187063] (25 PDB entries)
  8. 2327961Domain d3ag4u_: 3ag4 U: [172134]
    Other proteins in same PDB: d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4g_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag4u_

PDB Entry: 3ag4 (more details), 2.05 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3ag4u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag4u_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3ag4u_:

Click to download the PDB-style file with coordinates for d3ag4u_.
(The format of our PDB-style files is described here.)

Timeline for d3ag4u_: