| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) ![]() automatically mapped to Pfam PF02935 |
| Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81424] (35 PDB entries) |
| Domain d3ag4l_: 3ag4 L: [172126] Other proteins in same PDB: d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4z_ automated match to d1occl_ complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag4 (more details), 2.05 Å
SCOPe Domain Sequences for d3ag4l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag4l_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
Timeline for d3ag4l_:
View in 3DDomains from other chains: (mouse over for more information) d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_ |