| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) ![]() |
| Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
| Protein automated matches [190271] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187063] (16 PDB entries) |
| Domain d3ag4h_: 3ag4 H: [172122] Other proteins in same PDB: d3ag4a_, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4g_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_ automated match to d1ocrh_ complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag4 (more details), 2.05 Å
SCOPe Domain Sequences for d3ag4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag4h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki
Timeline for d3ag4h_: