SCOP 1.71: Domain d3pal__: 3pal -

Lineage for d3pal__ (3pal -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (2 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (7 species)

7. Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries)

8. Domain d3pal__: 3pal - [17212]
   complexed with ca, mg

Details for d3pal__

PDB Entry: 3pal, 2.4 Å

PDB Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments

SCOP Domain Sequences for d3pal__:

Sequence; same for both SEQRES and ATOM records:

>d3pal__ a.39.1.4 (-) Parvalbumin {Pike (Esox lucius)}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika

Timeline for d3pal__:

• d3pal__ first appeared (with stable ids) in SCOP 1.55
  
• d3pal__ appears in SCOP 1.69
  
• d3pal__ is called d3pala_ in SCOP 1.73
  
• d3pal__ appears in the current release, SCOPe 2.08, called d3pala_