Lineage for d3pal__ (3pal -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 280805Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 280933Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 280938Protein Parvalbumin [47495] (6 species)
  7. 280950Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries)
  8. 280958Domain d3pal__: 3pal - [17212]
    complexed with ca, mg

Details for d3pal__

PDB Entry: 3pal (more details), 2.4 Å

PDB Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments

SCOP Domain Sequences for d3pal__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pal__ a.39.1.4 (-) Parvalbumin {Pike (Esox lucius)}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika

SCOP Domain Coordinates for d3pal__:

Click to download the PDB-style file with coordinates for d3pal__.
(The format of our PDB-style files is described here.)

Timeline for d3pal__: