Lineage for d3pal__ (3pal -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.4: Parvalbumin [47492] (2 proteins) Protein Parvalbumin [47495] (6 species) Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries) 
Domain d3pal__: 3pal - [17212]
Details for d3pal__
PDB Entry: 3pal (more details), 2.4 Å
PDB Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
SCOP Domain Sequences for d3pal__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pal__ a.39.1.4 (-) Parvalbumin {Pike (Esox lucius)}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika
SCOP Domain Coordinates for d3pal__:
Click to download the PDB-style file with coordinates for d3pal__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pal__:
- d3pal__ appears in SCOP 1.57
- d3pal__ appears in the current release, SCOPe 2.08, called d3pala_
View in 3D