Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) automatically mapped to Pfam PF02284 |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
Protein Cytochrome c oxidase subunit E [48481] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries) |
Domain d3ag4e_: 3ag4 E: [172119] Other proteins in same PDB: d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_ automated match to d1occe_ complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag4 (more details), 2.05 Å
SCOPe Domain Sequences for d3ag4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag4e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d3ag4e_:
View in 3D Domains from other chains: (mouse over for more information) d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_ |